Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HS1BP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human HS1BP3 (NP_071905.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HS1BP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human HS1BP3 (NP_071905.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00019A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HS1BP3 |
| Target Synonyms | ETM2; HS1-BP3; HS1BP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, HepG2, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human HS1BP3 (NP_071905.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEA | Uniprot ID | Q53T59 |
Uniprot Id
Q53T59
Target Species
Human
Target Name
HS1BP3
Target Full Name
HCLS1-binding protein 3
Target Function
May be a modulator of IL-2 signaling.
Target Synonyms
ETM2; FLJ14249; H1BP3_HUMAN; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 binding protein 3; HS1 BP3; HS1-binding protein 3; Hs1bp3; HSP1BP-3
Target Background
The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
