Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IBSP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IBSP (NP_004958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IBSP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IBSP (NP_004958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09989A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IBSP |
| Target Synonyms | BSP; BNSP; SP-II; BSP-II; IBSP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, U-138MG, U2OS | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IBSP (NP_004958.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEENGDDSSEEEEEEEETSNEGENNEESNEDEDS | Uniprot ID | P21815 |
Uniprot Id
P21815
Target Species
Human
Target Name
IBSP
Target Full Name
Integrin-binding sialoprotein
Target Function
Binds tightly to hydroxyapatite. Appears to form an integral part of the mineralized matrix. Probably important to cell-matrix interaction. Promotes Arg-Gly-Asp-dependent cell attachment.
Target Subcellular Location
Secreted.
Target Research Area
others
Target Synonyms
BNSP; Bone sialoprotein 2; Bone sialoprotein II; BSP; BSP II; BSPII; Cell binding sialoprotein; Cell-binding sialoprotein; IBSP; Integrin binding sialoprotein; Integrin-binding sialoprotein; SIAL_HUMAN; SPII
Target Background
The protein encoded by this gene is a major structural protein of the bone matrix. It constitutes approximately 12% of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
