-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICE2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human ICE2 (NP_078887.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ICE2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human ICE2 (NP_078887.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICE2 |
| Target Synonyms | BRCC1; NARG2; ICE2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 660-800 of human ICE2 (NP_078887.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SRKVPELPLMNLENSKQPSVSEQLSGPSDSSSWPKSGWPSAFQKPKGRLPYELQDYVEDTSEYLAPQEGNFVYKLFSLQDLLLLVRCSVQRIETRPRSKKRKKIRRQFPVYVLPKVEYQACYGVEALTESELCRLWTESLL | Uniprot ID | Q659A1 |
Uniprot Id
Q659A1
Target Species
Human
Target Name
ICE2
Target Full Name
Little elongation complex subunit 2
Target Function
Component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III.
Target Subcellular Location
Nucleus. Note=Colocalizes with COIL in subnuclear Cajal and histone locus bodies. Translocates in the LEC complex to Cajal and histone locus bodies at snRNA genes in a ICE1-dependent manner. Associates to transcriptionally active chromatin at snRNA genes.
Target Protein Families
ICE2 family
Target Tissue Specificity
Expressed at low levels in lung and testis.
Target Synonyms
ICE2; BRCC1; NARG2; UNQ3101/PRO10100; Little elongation complex subunit 2; Interactor of little elongator complex ELL subunit 2; NMDA receptor-regulated protein 2
Target Background
This gene encodes a protein component of the little elongation complex (LEC), which plays a role in small nuclear RNA (snRNA) transcription. The LEC regulates snRNA transcription by enhancing both RNA Polymerase II occupancy and transcriptional elongation. The encoded protein and other LEC components have been shown to localize to Cajal bodies, which are sites of ribonucleoprotein (RNP) complex assembly. Pseudogenes of this gene have been identified on chromosomes 3 and 4.
Notification