Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against JunD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human JunD (NP_005345.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against JunD was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human JunD (NP_005345.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10994A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | JUND |
| Target Synonyms | AP-1; JunD | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, HepG2, Jurkat, Mouse liver, Mouse pancreas, Mouse testis, Rat liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human JunD (NP_005345.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPE | Uniprot ID | P17535 |
Uniprot Id
P17535
Target Species
Human
Target Name
JUND
Target Full Name
Transcription factor JunD
Target Function
Transcription factor binding AP-1 sites.
Target Subcellular Location
Nucleus.
Target Protein Families
BZIP family, Jun subfamily
Target Synonyms
Activator protein 1; AP 1; AP1; Jun D; jun D proto oncogene; Jund; JunD FL isoform; JUND_HUMAN; Transcription factor jun D; Transcription factor jun-D
Target Background
The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms (PMID:12105216).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
