-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LCN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-176 of human LCN1 (NP_002288.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against LCN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-176 of human LCN1 (NP_002288.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00911A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LCN1 |
| Target Synonyms | TP; TLC; PMFA; VEGP; LCN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HL-60 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-176 of human LCN1 (NP_002288.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD | Uniprot ID | P31025 |
Uniprot Id
P31025
Target Species
Human
Target Name
LCN1
Target Full Name
Lipocalin-1
Target Function
Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket.
Target Subcellular Location
Secreted.
Target Protein Families
Calycin superfamily, Lipocalin family
Target Tissue Specificity
Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
Target Research Area
Cell Biology
Target Synonyms
LCN1; LCN1_HUMAN; Lipocalin 1 (protein migrating faster than albumin, tear prealbumin); Lipocalin 1 like 2; Lipocalin-1; PMFA ; Tear lipocalin; Tear prealbumin; Tlc; TP; VEG protein; VEGP ; Von Ebner gland protein
Target Background
This gene encodes a member of the lipocalin family of small secretory proteins. Lipocalins are extracellular transport proteins that bind to a variety of hydrophobic ligands. The encoded protein is the primary lipid binding protein in tears and is overproduced in response to multiple stimuli including infection and stress. The encoded protein may be a marker for chromosome aneuploidy as well as an autoantigen in Sjogren's syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and two pseudogenes of this gene are also located on the long arm of chromosome 9.
Notification