Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LETMD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 161-360 of human LETMD1 (NP_056231.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against LETMD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 161-360 of human LETMD1 (NP_056231.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04400A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LETMD1 |
| Target Synonyms | HCCR; HCCR1; HCCR2; HCCR-1; HCCR-2; HCRR-2; SLC55A3; 1110019O13Rik; LETMD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 161-360 of human LETMD1 (NP_056231.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVLLSTNYLGTRR | Uniprot ID | Q6P1Q0 |
Uniprot Id
Q6P1Q0
Target Species
Human
Target Name
LETMD1
Target Full Name
LETM1 domain-containing protein 1
Target Function
Involved in tumorigenesis and may function as a negative regulator of the p53/TP53.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Target Tissue Specificity
Kidney, liver, skeletal muscle, heart and brain. Overexpressed in various tumors including leukemia, lymphoma, and carcinomas of the breast, kidney, ovary, stomach, colon and uterine cervix.
Target Synonyms
LETMD1LETM1 domain-containing protein 1; Cervical cancer 1 proto-oncogene protein p40; Cervical cancer proto-oncogene 2 protein; HCCR-1; HCRR-2
Target Background
This gene encodes a mitochondrial outer membrane protein. It has a potential role in tumorigenesis, which may result from negative regulation of the p53 tumor suppressor gene. Alternatively spliced transcript variants have been noted for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
