Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MCL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MCL1 (NP_068779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
The antibody against MCL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MCL1 (NP_068779.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
Western blot analysis of various lysates, using MCL1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-08183A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MCL1 |
| Target Synonyms | TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT; MCL1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Ramos | Application | WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MCL1 (NP_068779.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG | Uniprot ID | Q07820 |
Uniprot Id
Q07820
Target Species
Human
Target Name
MCL1
Target Full Name
Induced myeloid leukemia cell differentiation protein Mcl-1
Target Function
Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isoform 2 promotes apoptosis.
Target Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm. Mitochondrion. Nucleus, nucleoplasm. Note=Cytoplasmic, associated with mitochondria.
Target Protein Families
Bcl-2 family
Target Synonyms
TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT; Phospho-MCL1-T163
Target Background
This gene encodes an anti-apoptotic protein, which is a member of the Bcl-2 family. Alternative splicing results in multiple transcript variants. The longest gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene products (isoform 2 and isoform 3) promote apoptosis and are death-inducing.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
