-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAXE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 48-170 of human NAXE (NP_658985.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAXE was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 48-170 of human NAXE (NP_658985.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04722A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAXE |
| Target Synonyms | AIBP; PEBEL; YJEFN1; APOA1BP; NAXE | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, 293T, LO2, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 48-170 of human NAXE (NP_658985.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP | Uniprot ID | Q8NCW5 |
Uniprot Id
Q8NCW5
Target Species
Human
Target Name
NAXE
Target Full Name
NAD(P)H-hydrate epimerase
Target Function
Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S-specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX. Accelerates cholesterol efflux from endothelial cells to high-density lipoprotein (HDL) and thereby regulates angiogenesis.
Target Involvement
Encephalopathy, progressive, early-onset, with brain edema and/or leukoencephalopathy (PEBEL)
Target Subcellular Location
Mitochondrion. Secreted.
Target Protein Families
NnrE/AIBP family
Target Tissue Specificity
Ubiquitously expressed, with highest levels in kidney, heart and liver. Present in cerebrospinal fluid and urine but not in serum from healthy patients. Present in serum of sepsis patients (at protein level).
Target Synonyms
NAXE; AIBP; APOA1BP; YJEFN1; NAD(P)H-hydrate epimerase; EC 5.1.99.6; Apolipoprotein A-I-binding protein; AI-BP; NAD(P)HX epimerase; YjeF N-terminal domain-containing protein 1; YjeF_N1
Target Background
The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.
Notification