Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ONECUT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-292 of human ONECUT1 (NP_004489.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ONECUT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-292 of human ONECUT1 (NP_004489.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03231A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ONECUT1 |
| Target Synonyms | HNF6; HNF-6; HNF6A; ONECUT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 167-292 of human ONECUT1 (NP_004489.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEI | Uniprot ID | Q9UBC0 |
Uniprot Id
Q9UBC0
Target Species
Human
Target Name
ONECUT1
Target Full Name
Hepatocyte nuclear factor 6
Target Function
Transcriptional activator. Binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. Important for liver genes transcription.
Target Subcellular Location
Nucleus.
Target Protein Families
CUT homeobox family
Target Tissue Specificity
Highly expressed in liver; lower expression in testis and skin.
Target Synonyms
hepatocyte nuclear factor 6 alpha; Hepatocyte nuclear factor 6; HNF 6; HNF-6; HNF6_HUMAN; HNF6A; One cut domain family member 1; One cut homeobox 1; Onecut1
Target Background
This gene encodes a member of the Cut homeobox family of transcription factors. Expression of the encoded protein is enriched in the liver, where it stimulates transcription of liver-expressed genes, and antagonizes glucocorticoid-stimulated gene transcription. This gene may influence a variety of cellular processes including glucose metabolism, cell cycle regulation, and it may also be associated with cancer. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
