-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PASK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1194-1323 of human PASK (NP_055963.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PASK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1194-1323 of human PASK (NP_055963.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-01067A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PASK |
| Target Synonyms | STK37; PASKIN; PASK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, Jurkat, Raji, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1194-1323 of human PASK (NP_055963.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS | Uniprot ID | Q96RG2 |
Uniprot Id
Q96RG2
Target Species
Human
Target Name
PASK
Target Full Name
PAS domain-containing serine/threonine-protein kinase
Target Function
Serine/threonine-protein kinase involved in energy homeostasis and protein translation. Phosphorylates EEF1A1, GYS1, PDX1 and RPS6. Probably plays a role under changing environmental conditions (oxygen, glucose, nutrition), rather than under standard conditions. Acts as a sensor involved in energy homeostasis: regulates glycogen synthase synthesis by mediating phosphorylation of GYS1, leading to GYS1 inactivation. May be involved in glucose-stimulated insulin production in pancreas and regulation of glucagon secretion by glucose in alpha cells; however such data require additional evidences. May play a role in regulation of protein translation by phosphorylating EEF1A1, leading to increase translation efficiency. May also participate in respiratory regulation.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Localizes in the nucleus of testis germ cells and in the midpiece of sperm tails.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Target Tissue Specificity
Ubiquitously expressed, with slightly higher expression in brain, prostate and testis. Reduced expression was found in placenta. Present in germ cells of testis and in the midpiece of sperm tails (at protein level).
Target Synonyms
DKFZP434O051; DKFZp686P2031; hPASK; KIAA0135; MGC93882; mKIAA0135; PAS domain containing serine/threonine kinase; PAS domain containing serine/threonine protein kinase; PAS domain-containing serine/threonine-protein kinase; PAS kinase; PAS serine/threonine kinase; PAS-kinase; Pask; PASK_HUMAN; PASKIN; STK 37; STK37
Target Background
This gene encodes a member of the serine/threonine kinase family that contains two PAS domains. Expression of this gene is regulated by glucose, and the encoded protein plays a role in the regulation of insulin gene expression. Downregulation of this gene may play a role in type 2 diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification