-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCNA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PCNA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-12563A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCNA |
| Target Synonyms | ATLD2; PCNA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, C2C12, COS-7, MCF7, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS | Uniprot ID | P12004 |
Uniprot Id
P12004
Target Species
Human
Target Name
PCNA
Target Full Name
Proliferating cell nuclear antigen
Target Function
Auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Plays a key role in DNA damage response (DDR) by being conveniently positioned at the replication fork to coordinate DNA replication with DNA repair and DNA damage tolerance pathways. Acts as a loading platform to recruit DDR proteins that allow completion of DNA replication after DNA damage and promote postreplication repair: Monoubiquitinated PCNA leads to recruitment of translesion (TLS) polymerases, while 'Lys-63'-linked polyubiquitination of PCNA is involved in error-free pathway and employs recombination mechanisms to synthesize across the lesion.
Target Involvement
Ataxia-telangiectasia-like disorder 2 (ATLD2)
Target Subcellular Location
Nucleus.
Target Protein Families
PCNA family
Target Research Area
Cancer
Target Synonyms
ATLD2; cb16; Cyclin; DNA polymerase delta auxiliary protein; etID36690.10; fa28e03; fb36g03; HGCN8729; MGC8367; Mutagen-sensitive 209 protein; OTTHUMP00000030189; OTTHUMP00000030190; PCNA; Pcna/cyclin; PCNA_HUMAN; PCNAR; Polymerase delta accessory protein; Proliferating cell nuclear antigen; wu:fa28e03; wu:fb36g03
Target Background
The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome.
Notification