-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDK4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 312-411 of human PDK4 (NP_002603.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PDK4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 312-411 of human PDK4 (NP_002603.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04194A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDK4 |
| Target Synonyms | PDK4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 312-411 of human PDK4 (NP_002603.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDAIIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM | Uniprot ID | Q16654 |
Uniprot Id
Q16654
Target Species
Human
Target Name
PDK4
Target Full Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial
Target Function
Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Inhibition of pyruvate dehydrogenase decreases glucose utilization and increases fat metabolism in response to prolonged fasting and starvation. Plays an important role in maintaining normal blood glucose levels under starvation, and is involved in the insulin signaling cascade. Via its regulation of pyruvate dehydrogenase activity, plays an important role in maintaining normal blood pH and in preventing the accumulation of ketone bodies under starvation. In the fed state, mediates cellular responses to glucose levels and to a high-fat diet. Regulates both fatty acid oxidation and de novo fatty acid biosynthesis. Plays a role in the generation of reactive oxygen species. Protects detached epithelial cells against anoikis. Plays a role in cell proliferation via its role in regulating carbohydrate and fatty acid metabolism.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
PDK/BCKDK protein kinase family
Target Tissue Specificity
Ubiquitous; highest levels of expression in heart and skeletal muscle.
Target Synonyms
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4; FLJ40832; mitochondrial; Pdk4; PDK4_HUMAN; Pyruvate dehydrogenase [lipoamide] kinase isozyme 4 mitochondrial ; Pyruvate dehydrogenase kinase 4; Pyruvate dehydrogenase kinase isoenzyme 4; Pyruvate dehydrogenase kinase isoform 4; Pyruvate dehydrogenase kinase isozyme 4; Pyruvate dehydrogenase kinase isozyme 4 mitochondrial
Target Background
This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.
Notification