-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PHC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 750-940 of human PHC1 (NP_004417.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PHC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 750-940 of human PHC1 (NP_004417.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03648A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PHC1 |
| Target Synonyms | EDR1; HPH1; RAE28; MCPH11; PHC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 750-940 of human PHC1 (NP_004417.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRW | Uniprot ID | P78364 |
Uniprot Id
P78364
Target Species
Human
Target Name
PHC1
Target Full Name
Polyhomeotic-like protein 1
Target Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Required for proper control of cellular levels of GMNN expression.
Target Involvement
Microcephaly 11, primary, autosomal recessive (MCPH11)
Target Subcellular Location
Nucleus.
Target Synonyms
Early development regulatory protein 1; hPH1; mPH1; PH1; Phc1; PHC1_HUMAN; Polyhomeotic-like protein 1; Rae28
Target Background
This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein.
Notification