-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLA2G7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 51-240 of human PLA2G7 (NP_005075.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLA2G7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 51-240 of human PLA2G7 (NP_005075.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10262A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLA2G7 |
| Target Synonyms | PAFAD; PAFAH; LP-PLA2; LDL-PLA2; PLA2G7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 51-240 of human PLA2G7 (NP_005075.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID | Uniprot ID | Q13093 |
Uniprot Id
Q13093
Target Species
Human
Target Name
PLA2G7
Target Full Name
Platelet-activating factor acetylhydrolase
Target Function
Lipoprotein-associated calcium-independent phospholipase A2 involved in phospholipid catabolism during inflammatory and oxidative stress response. At the lipid-aqueous interface, hydrolyzes the ester bond of fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity). Specifically targets phospholipids with a short-chain fatty acyl group at sn-2 position. Can hydrolyze phospholipids with long fatty acyl chains, only if they carry oxidized functional groups. Hydrolyzes and inactivates platelet-activating factor (PAF, 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine), a potent proinflammatory signaling lipid that acts through PTAFR on various innate immune cells. Hydrolyzes oxidatively truncated phospholipids carrying an aldehyde group at omega position, preventing their accumulation in low-density lipoprotein (LDL) particles and uncontrolled proinflammatory effects. As part of high-density lipoprotein (HDL) particles, can hydrolyze phospholipids having long-chain fatty acyl hydroperoxides at sn-2 position and protect against potential accumulation of these oxylipins in the vascular wall. Catalyzes the release from membrane phospholipids of F2-isoprostanes, lipid biomarkers of cellular oxidative damage.
Target Involvement
Platelet-activating factor acetylhydrolase deficiency (PAFAD); Asthma (ASTHMA); Atopic hypersensitivity (ATOPY)
Target Subcellular Location
Secreted, extracellular space.
Target Protein Families
AB hydrolase superfamily, Lipase family
Target Tissue Specificity
Plasma. Secreted by macrophages (at protein level).
Target Synonyms
PLA2G7; LDL-PLA2; LP-PLA2; PAFAD; PAFAH; phospholipase A2 group VII; Human PLA2G7/PAF-AH/Lp-PLA2
Target Background
The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
Notification