Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLLP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLLP (NP_057077.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PLLP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLLP (NP_057077.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04800A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLLP |
| Target Synonyms | PMLP; TM4SF11; PLLP | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PLLP (NP_057077.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRSRLGALMLLQLVLGLLVWALIADTPYHLYPAYGWVMFVAVFLWLVTIVLFNLYLFQLHMKLYMVPW | Uniprot ID | Q9Y342 |
Uniprot Id
Q9Y342
Target Species
Human
Target Name
PLLP
Target Full Name
Plasmolipin
Target Function
Appears to be involved in myelination. Could also participate in ion transport events as addition of plasmolipin to lipid bilayers induces the formation of ion channels, which are voltage-dependent and K(+)-selective.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
MAL family
Target Synonyms
PLLP; PMLP; TM4SF11; Plasmolipin; Plasma membrane proteolipid
Target Background
Predicted to be a structural constituent of myelin sheath. Predicted to be involved in myelination. Predicted to be located in compact myelin and membrane raft. Predicted to be integral component of membrane. Biomarker of schizophrenia.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
