-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PMS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PMS2 (NP_000526.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PMS2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PMS2 (NP_000526.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02777A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PMS2 |
| Target Synonyms | MLH4; PMS-2; PMSL2; HNPCC4; LYNCH4; MMRCS4; PMS2CL; PMS2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PMS2 (NP_000526.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERAESSSTEPAKAIKPIDRKSVHQICSGQVVLSLSTAVKELVENSLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTLKHHTSKIQEFADLTQ | Uniprot ID | P54278 |
Uniprot Id
P54278
Target Species
Human
Target Name
PMS2
Target Full Name
Mismatch repair endonuclease PMS2
Target Function
Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MLH1 to form MutL alpha. DNA repair is initiated by MutS alpha (MSH2-MSH6) or MutS beta (MSH2-MSH3) binding to a dsDNA mismatch, then MutL alpha is recruited to the heteroduplex. Assembly of the MutL-MutS-heteroduplex ternary complex in presence of RFC and PCNA is sufficient to activate endonuclease activity of PMS2. It introduces single-strand breaks near the mismatch and thus generates new entry points for the exonuclease EXO1 to degrade the strand containing the mismatch. DNA methylation would prevent cleavage and therefore assure that only the newly mutated DNA strand is going to be corrected. MutL alpha (MLH1-PMS2) interacts physically with the clamp loader subunits of DNA polymerase III, suggesting that it may play a role to recruit the DNA polymerase III to the site of the MMR. Also implicated in DNA damage signaling, a process which induces cell cycle arrest and can lead to apoptosis in case of major DNA damages.
Target Involvement
Hereditary non-polyposis colorectal cancer 4 (HNPCC4); Mismatch repair cancer syndrome (MMRCS)
Target Subcellular Location
Nucleus.
Target Protein Families
DNA mismatch repair MutL/HexB family
Target Synonyms
DNA mismatch repair gene homologue ; DNA mismatch repair protein PMS2; H_DJ0042M02.9; HNPCC4; Mismatch repair endonuclease PMS2; Mismatch repair gene PMSL2; MLH4; PMS 2; PMS1 homolog 2 mismatch repair system; PMS1 protein homolog 2; PMS2; PMS2 postmeiotic segregation increased 2 ; PMS2 postmeiotic segregation increased 2 (S. cerevisiae); PMS2_HUMAN; PMS2CL; PMSL2; Postmeiotic segregation increased; S. cerevisiae; 2
Target Background
The protein encoded by this gene is a key component of the mismatch repair system that functions to correct DNA mismatches and small insertions and deletions that can occur during DNA replication and homologous recombination. This protein forms heterodimers with the gene product of the mutL homolog 1 (MLH1) gene to form the MutL-alpha heterodimer. The MutL-alpha heterodimer possesses an endonucleolytic activity that is activated following recognition of mismatches and insertion/deletion loops by the MutS-alpha and MutS-beta heterodimers, and is necessary for removal of the mismatched DNA. There is a DQHA(X)2E(X)4E motif found at the C-terminus of the protein encoded by this gene that forms part of the active site of the nuclease. Mutations in this gene have been associated with hereditary nonpolyposis colorectal cancer (HNPCC; also known as Lynch syndrome) and Turcot syndrome.
Notification