-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against POU3F2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human POU3F2 (NP_005595.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against POU3F2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human POU3F2 (NP_005595.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04297A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | POU3F2 |
| Target Synonyms | BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7; N-Oct3; POU3F2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-68 of human POU3F2 (NP_005595.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHG | Uniprot ID | P20265 |
Uniprot Id
P20265
Target Species
Human
Target Name
POU3F2
Target Full Name
POU domain, class 3, transcription factor 2
Target Function
Transcription factor that plays a key role in neuronal differentiation. Binds preferentially to the recognition sequence which consists of two distinct half-sites, ('GCAT') and ('TAAT'), separated by a non-conserved spacer region of 0, 2, or 3 nucleotides. Acts as a transcriptional activator when binding cooperatively with SOX4, SOX11, or SOX12 to gene promoters. The combination of three transcription factors, ASCL1, POU3F2/BRN2 and MYT1L, is sufficient to reprogram fibroblasts and other somatic cells into induced neuronal (iN) cells in vitro. Acts downstream of ASCL1, accessing chromatin that has been opened by ASCL1, and promotes transcription of neuronal genes.
Target Subcellular Location
Nucleus.
Target Protein Families
POU transcription factor family, Class-3 subfamily
Target Tissue Specificity
Expressed specifically in the neuroectodermal cell lineage.
Target Synonyms
Brain 2; Brain specific homeobox/POU domain protein 2; Brain-2; Brain-specific homeobox/POU domain protein 2; BRN 2; Brn-2; BRN2; N Oct 3; N OCT 3 Gene; N Oct3; Nervous system specific octamer binding transcription factor; Nervous system-specific octamer-binding transcription factor N-Oct-3; OCT 7; Oct-7; OCT7; Octamer Binding Transcription Factor 7; Octamer-binding protein 7; Octamer-binding transcription factor 7; OTF 7; OTF-7; OTF7; PO3F2_HUMAN; POU class 3 homeobox 2,; POU domain class 3 transcription factor 2; POU domain, class 3, transcription factor 2; Pou3f2; POUF 3; POUF3; Protein Brn 2
Target Background
This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells.
Notification