Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-100 of human PPA2 (NP_008834.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PPA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 33-100 of human PPA2 (NP_008834.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10050A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPA2 |
| Target Synonyms | SCFI; SCFAI; HSPC124; SID6-306; PPA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, OVCAR3, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 33-100 of human PPA2 (NP_008834.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPR | Uniprot ID | Q9H2U2 |
Uniprot Id
Q9H2U2
Target Species
Human
Target Name
PPA2
Target Full Name
Inorganic pyrophosphatase 2, mitochondrial
Target Function
Hydrolyzes inorganic pyrophosphate. This activity is essential for correct regulation of mitochondrial membrane potential, and mitochondrial organization and function.
Target Involvement
Sudden cardiac failure, alcohol-induced (SCFAI); Sudden cardiac failure, infantile (SCFI)
Target Subcellular Location
Mitochondrion.
Target Protein Families
PPase family
Target Tissue Specificity
Detected in brain, gastric carcinoma, lung, ovary, skeletal muscle, umbilical cord blood and a cell line derived from kidney proximal tubule epithelium.
Target Synonyms
HSPC124; Inorganic pyrophosphatase 2; Inorganic pyrophosphatase 2, mitochondrial; IPYR2_HUMAN; mitochondrial; Ppa2; PPase 2; PPase2; Pyrophosphatase (inorganic) 2; Pyrophosphatase SID6 306 ; Pyrophosphatase SID6-306; Pyrophosphate phospho-hydrolase 2; SID6 306
Target Background
The protein encoded by this gene is localized to the mitochondrion, is highly similar to members of the inorganic pyrophosphatase (PPase) family, and contains the signature sequence essential for the catalytic activity of PPase. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
