-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PPARA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 201-300 of human PPARA (NP_001001928.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
The antibody against PPARA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 201-300 of human PPARA (NP_001001928.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
| Cat.No | ADA-11989A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PPARA |
| Target Synonyms | PPAR; NR1C1; hPPAR; PPARalpha; PPARA | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 201-300 of human PPARA (NP_001001928.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL | Uniprot ID | Q07869 |
Uniprot Id
Q07869
Target Species
Human
Target Name
PPARA
Target Full Name
Peroxisome proliferator-activated receptor alpha
Target Function
Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety. Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2. May be required for the propagation of clock information to metabolic pathways regulated by PER2.
Target Subcellular Location
Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR1 subfamily
Target Tissue Specificity
Skeletal muscle, liver, heart and kidney. Expressed in monocytes.
Target Research Area
Cancer
Target Synonyms
hPPAR; MGC2237; MGC2452; NR1C1; Nuclear receptor subfamily 1 group C member 1; OTTHUMP00000197740; OTTHUMP00000197741; Peroxisome proliferative activated receptor alpha; Peroxisome proliferator activated receptor alpha; Peroxisome proliferator-activated receptor alpha; PPAR; PPAR-alpha; ppara; PPARA_HUMAN; PPARalpha
Target Background
Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple alternatively spliced transcript variants have been described for this gene, although the full-length nature of only two has been determined.
Notification