-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PUS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 308-427 of human PUS1 (NP_079491.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PUS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 308-427 of human PUS1 (NP_079491.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01124A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PUS1 |
| Target Synonyms | MLASA1; PUS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 308-427 of human PUS1 (NP_079491.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD | Uniprot ID | Q9Y606 |
Uniprot Id
Q9Y606
Target Species
Human
Target Name
PUS1
Target Full Name
Pseudouridylate synthase 1 homolog
Target Function
Converts specific uridines to PSI in a number of tRNA substrates. Acts on positions 27/28 in the anticodon stem and also positions 34 and 36 in the anticodon of an intron containing tRNA. Involved in regulation of nuclear receptor activity through pseudouridylation of SRA1 RNA.
Target Involvement
Myopathy with lactic acidosis and sideroblastic anemia 1 (MLASA1)
Target Subcellular Location
[Isoform 1]: Mitochondrion.; [Isoform 2]: Nucleus.
Target Protein Families
TRNA pseudouridine synthase TruA family
Target Tissue Specificity
Widely expressed. High levels of expression found in brain and skeletal muscle.
Target Synonyms
A730013B20Rik; DOBI; MGC112655; MGC11268; MLASA; MLASA1; mPus1p; Pseudouridine synthase 1; Pseudouridylate synthase 1; PUS1; tRNA pseudouridine synthase A, mitochondrial; tRNA pseudouridine(38-40) synthase; tRNA pseudouridylate synthase I; tRNA uridine isomerase I; tRNA-uridine isomerase I; TRUA_HUMAN
Target Background
This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.
Notification