-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RRP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RRP8 (NP_056139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RRP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RRP8 (NP_056139.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07518A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RRP8 |
| Target Synonyms | NML; KIAA0409; RRP8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse spleen, Rat kidney, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RRP8 (NP_056139.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GPPCSDSEEEVERKKKCHKQALVGSDSAEDEKRKRKCQKHAPINSAQHLDNVDQTGPKAWKGSTTNDPPKQSPGSTSPKPPHTLSRKQWRNRQKNKRRCKN | Uniprot ID | O43159 |
Uniprot Id
O43159
Target Species
Human
Target Name
RRP8
Target Full Name
Ribosomal RNA-processing protein 8
Target Function
Essential component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. In the complex, RRP8 binds to H3K9me2 and probably acts as a methyltransferase. Its substrates are however unknown.
Target Subcellular Location
Nucleus, nucleolus. Note=Localizes at rDNA locus.
Target Protein Families
Methyltransferase superfamily, RRP8 family
Target Synonyms
Cerebral protein 1; hypothetical protein LOC23378; KIAA0409; NML; Nucleomethylin; Ribosomal RNA processing 8 methyltransferase homolog; Ribosomal RNA processing 8, methyltransferase, homolog (yeast); Ribosomal RNA processing protein 8; Ribosomal RNA-processing protein 8; RRP 8; RRP8; RRP8 methyltransferase homolog; RRP8_HUMAN
Target Background
Enables methylated histone binding activity. Involved in several processes, including cellular response to glucose starvation; intrinsic apoptotic signaling pathway by p53 class mediator; and regulation of gene expression. Located in several cellular components, including cytosol; nuclear lumen; and rDNA heterochromatin. Part of chromatin silencing complex.
Notification