-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RYBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RYBP (NP_036366.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RYBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RYBP (NP_036366.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05548A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RYBP |
| Target Synonyms | AAP1; DEDAF; YEAF1; APAP-1; RYBP | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RYBP (NP_036366.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF | Uniprot ID | Q8N488 |
Uniprot Id
Q8N488
Target Species
Human
Target Name
RYBP
Target Full Name
RING1 and YY1-binding protein
Target Function
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Component of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females. May stimulate ubiquitination of histone H2A 'Lys-119' by recruiting the complex to target sites. Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes. May also regulate the ubiquitin-mediated proteasomal degradation of other proteins like FANK1 to regulate apoptosis. May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1. May bind to DNA. May play a role in the repression of tumor growth and metastasis in breast cancer by down-regulating SRRM3.
Target Subcellular Location
Nucleus. Cytoplasm. Nucleus, nucleoplasm.
Target Tissue Specificity
Down-regulated in breast cancer tissues and in several breast cancer cell lines (at protein level). Widely expressed with highest levels in lymphoid tissues and placenta.
Target Synonyms
2410018J24Rik; AAP 1; AAP1; APAP 1; APAP-1; APAP1; Apoptin associating protein 1; Apoptin-associating protein 1; cb337; Death effector domain associated factor; Death effector domain-associated factor; Death effector domain-associated factor B; DED associated factor; DED-associated factor; DED-associated factor B; DEDAF; MGC62213; RING1 and YY1 binding protein a; RING1 and YY1 binding protein; RING1 and YY1-binding protein; RING1 and YY1-binding protein B; Ring1 interactor RYBP; RYBP; RYBP_HUMAN; rybpa; wu:fi34f03; YEAF 1; YEAF1; YY1 and E4TF1 associated factor 1; YY1 and E4TF1-associated factor 1; YY1- and E4TF1/GABP-associated factor 1; zgc:153842
Target Background
Predicted to enable DNA binding activity and transcription coregulator activity. Involved in several processes, including histone H2A monoubiquitination; negative regulation of proteasomal ubiquitin-dependent protein catabolic process; and positive regulation of transcription, DNA-templated. Located in nucleoplasm. Colocalizes with PcG protein complex.
Notification