Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SDC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human SDC2 (NP_002989.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SDC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human SDC2 (NP_002989.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11332A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SDC2 |
| Target Synonyms | HSPG; CD362; HSPG1; SYND2; SDC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 19-144 of human SDC2 (NP_002989.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE | Uniprot ID | P34741 |
Uniprot Id
P34741
Target Species
Human
Target Name
SDC2
Target Full Name
Syndecan-2
Target Function
Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Syndecan proteoglycan family
Target Synonyms
SDC2; HSPG1; Syndecan-2; SYND2; Fibroglycan; Heparan sulfate proteoglycan core protein; HSPG; CD antigen CD362
Target Background
The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
