Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC18A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SLC18A2 (NP_003045.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SLC18A2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SLC18A2 (NP_003045.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04262A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC18A2 |
| Target Synonyms | SVAT; SVMT; VAT2; VMAT2; PKDYS2; SLC18A2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Rat stomach | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human SLC18A2 (NP_003045.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQ | Uniprot ID | Q05940 |
Uniprot Id
Q05940
Target Species
Human
Target Name
SLC18A2
Target Full Name
Synaptic vesicular amine transporter
Target Function
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
Target Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein.
Target Protein Families
Major facilitator superfamily, Vesicular transporter family
Target Synonyms
1110037L13Rik; 9330105E13; MGC120477; MGC120478; MGC26538; MGC90556; MNAT; Monoamine neurotransmitter transporter; Monoamine transporter; OTTHUMP00000020576; SLC18A2; Solute carrier family 18 (vesicular monoamine) member 2; Solute carrier family 18 member 2; SVAT; SVMT; Synaptic vesicle amine transporter brain; Synaptic vesicle monoamine transporter brain; Synaptic vesicular amine transporter; VAT 2; VAT2; Vesicle monoamine transporter type 2; Vesicle monoamine/H+ antiporter; Vesicular amine transporter 2; Vesicular monoamine transporter 2; VMAT 2; VMAT2; VMAT2_HUMAN
Target Background
This gene encodes an transmembrane protein that functions as an ATP-dependent transporter of monoamines, such as dopamine, norepinephrine, serotonin, and histamine. This protein transports amine neurotransmitters into synaptic vesicles. Polymorphisms in this gene may be associated with schizophrenia, bipolar disorder, and other neurological/psychiatric ailments.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
