Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human SNRK (NP_060189.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SNRK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human SNRK (NP_060189.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03546A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRK |
| Target Synonyms | HSNFRK; SNRK | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse liver, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human SNRK (NP_060189.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILFMLVCGQPPFQEANDSETLTMIMDCKYTVPSHVSK | Uniprot ID | Q9NRH2 |
Uniprot Id
Q9NRH2
Target Species
Human
Target Name
SNRK
Target Full Name
SNF-related serine/threonine-protein kinase
Target Function
May play a role in hematopoietic cell proliferation or differentiation. Potential mediator of neuronal apoptosis.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Target Tissue Specificity
Expressed in hematopoietic progenitor cells and leukemic cell lines. Weakly expressed in the testis.
Target Synonyms
DKFZp779A1866; FLJ20224; HSNFRK; KIAA0096; SNF related kinase; SNF related serine/threonine protein kinase; SNF-related serine/threonine-protein kinase; SNF1 related kinase; SNF1-related kinase; SNFRK; Snrk; SNRK_HUMAN
Target Background
SNRK is a member of the sucrose nonfermenting (SNF)-related kinase family of serine/threonine kinases (Kertesz et al., 2002 [PubMed 12234663]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
