Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SPTB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2080-2180 of human SPTB (NP_001020029.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SPTB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2080-2180 of human SPTB (NP_001020029.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03395A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SPTB |
| Target Synonyms | EL3; HS2; SPH2; HSPTB1; SPTB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2080-2180 of human SPTB (NP_001020029.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QIAERPAEETGPQEEEGETAGEAPVSHHAATERTSPGEEEGTWPQNLQQPPPPGQHKDGQKSTGDERPTTEPLFKVLDTPLSEGDEPATLPAPRDHGQSVQ | Uniprot ID | P11277 |
Uniprot Id
P11277
Target Species
Human
Target Name
SPTB
Target Full Name
Spectrin beta chain, erythrocytic
Target Function
Spectrin is the major constituent of the cytoskeletal network underlying the erythrocyte plasma membrane. It associates with band 4.1 and actin to form the cytoskeletal superstructure of the erythrocyte plasma membrane.
Target Involvement
Elliptocytosis 3 (EL3); Spherocytosis 2 (SPH2)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex.
Target Protein Families
Spectrin family
Target Synonyms
Beta I spectrin; Beta spectrin; Beta-I spectrin; EL3; erythrocyte; HS2; HSpTB1; Membrane cytoskeletal protein; Spectrin beta; Spectrin beta chain; Spectrin beta chain erythrocyte; Spectrin beta erythrocytic (includes spherocytosis clinical type I); Spectrin beta erythrocytic; SPH2; sptB; SPTB1; SPTB1_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
