-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SSTR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SSTR3 (NP_001042.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SSTR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human SSTR3 (NP_001042.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00563A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SSTR3 |
| Target Synonyms | SS3R; SST3; SS3-R; SS-3-R; SSR-28; SSTR3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, LO2, Mouse brain, Rat spleen, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SSTR3 (NP_001042.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEE | Uniprot ID | P32745 |
Uniprot Id
P32745
Target Species
Human
Target Name
SSTR3
Target Full Name
Somatostatin receptor type 3
Target Function
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Brain, pituitary and pancreas.
Target Synonyms
SSTR3; Somatostatin receptor type 3; SS-3-R; SS3-R; SS3R; SSR-28
Target Background
This gene encodes a member of the somatostatin receptor protein family. Somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of many hormones and other secretory proteins. Somatostatin has two active forms of 14 and 28 amino acids. The biological effects of somatostatins are mediated by a family of G-protein coupled somatostatin receptors that are expressed in a tissue-specific manner. Somatostatin receptors form homodimers and heterodimers with other members of the superfamily as well as with other G-protein coupled receptors and receptor tyrosine kinases. This protein is functionally coupled to adenylyl cyclase. Alternate splicing results in multiple transcript variants.
Notification