-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAZ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human TAZ (NP_056287.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TAZ was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human TAZ (NP_056287.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10770A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAZ |
| Target Synonyms | TAZ | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, NCI-H460 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human TAZ (NP_056287.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL | Uniprot ID | Q9GZV5 |
Uniprot Id
Q9GZV5
Target Species
Human
Target Name
WWTR1
Target Full Name
WW domain-containing transcription regulator protein 1
Target Function
Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. In conjunction with YAP1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. Plays a key role in coupling SMADs to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition.
Target Subcellular Location
Nucleus. Cytoplasm. Cell membrane.
Target Tissue Specificity
Highly expressed in kidney, heart, placenta and lung. Expressed in the thyroid tissue.
Target Synonyms
DKFZP586I1419; FLJ27004; FLJ45718; OTTHUMP00000215994; OTTHUMP00000215995; OTTHUMP00000215996; OTTHUMP00000216001; TAZ; Transcriptional co activator with PDZ binding motif; Transcriptional coactivator with PDZ binding motif; Transcriptional coactivator with PDZ-binding motif; WW domain containing transcription regulator 1; WW domain containing transcription regulator protein 1; WW domain-containing transcription regulator protein 1; WWTR 1; WWTR1; WWTR1_HUMAN
Target Background
Enables transcription coactivator activity. Involved in several processes, including hippo signaling; positive regulation of cell differentiation; and regulation of signal transduction. Located in cytosol and nuclear body.
Notification