-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against THOC4/ALYREF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human THOC4/THOC4/ALYREF (NP_005773.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against THOC4/ALYREF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human THOC4/THOC4/ALYREF (NP_005773.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-03606A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | THOC4/ALYREF |
| Target Synonyms | ALY; BEF; REF; THOC4; ALY/REF; THOC4/ALYREF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, B cells, HL-60, Mouse spleen, Mouse testis, Mouse thymus, SKOV3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human THOC4/THOC4/ALYREF (NP_005773.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFD | Uniprot ID | Q86V81 |
Uniprot Id
Q86V81
Target Species
Human
Target Name
ALYREF
Target Full Name
THO complex subunit 4
Target Function
Export adapter involved in nuclear export of spliced and unspliced mRNA. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NFX1 pathway). Component of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm. TREX recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production; ALYREF/THOC4 mediates the recruitment of the TREX complex to the intronless viral mRNA. Required for TREX complex assembly and for linking DDX39B to the cap-binding complex (CBC). In conjunction with THOC5 functions in NXF1-NXT1 mediated nuclear export of HSP70 mRNA; both proteins enhance the RNA binding activity of NXF1 and are required for NXF1 localization to the nuclear rim. Involved in the nuclear export of intronless mRNA; proposed to be recruited to intronless mRNA by ATP-bound DDX39B. Involved in transcription elongation and genome stability. Involved in mRNA export of C5-methylcytosine (m5C)-containing mRNAs: specifically recognizes and binds m5C mRNAs and mediates their nucleo-cytoplasmic shuttling.; Acts as chaperone and promotes the dimerization of transcription factors containing basic leucine zipper (bZIP) domains and thereby promotes transcriptional activation.
Target Subcellular Location
Nucleus. Nucleus speckle. Cytoplasm.
Target Protein Families
ALYREF family
Target Tissue Specificity
Expressed in a wide variety of cancer types.
Target Synonyms
Ally of AML-1 and LEF-1; Ally of AML1 and LEF1; ALY; ALY/REF; Aly/REF export factor; BEF; bZIP enhancing factor; bZIP-enhancing factor BEF; REF; THO complex 4; THO complex subunit 4; Tho4; thoc4; THOC4_HUMAN; Transcriptional coactivator Aly/REF; Transcriptional coactivator
Target Background
The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.
Notification