-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UACA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human UACA (NP_060473.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UACA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human UACA (NP_060473.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00942A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UACA |
| Target Synonyms | NUCLING; UACA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-1080, SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human UACA (NP_060473.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRSVFHVVTSKGNLECLNAILIH | Uniprot ID | Q9BZF9 |
Uniprot Id
Q9BZF9
Target Species
Human
Target Name
UACA
Target Full Name
Uveal autoantigen with coiled-coil domains and ankyrin repeats
Target Function
Regulates APAF1 expression and plays an important role in the regulation of stress-induced apoptosis. Promotes apoptosis by regulating three pathways, apoptosome up-regulation, LGALS3/galectin-3 down-regulation and NF-kappa-B inactivation. Regulates the redistribution of APAF1 into the nucleus after proapoptotic stress. Down-regulates the expression of LGALS3 by inhibiting NFKB1.; Modulates isoactin dynamics to regulate the morphological alterations required for cell growth and motility. Interaction with ARF6 may modulate cell shape and motility after injury. May be involved in multiple neurite formation.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, cytoskeleton. Note=Expressed diffusely in cytoplasm.
Target Tissue Specificity
Highly expressed in skeletal muscle, heart, kidney and pancreas. Expressed in choroid, retina and epidermal melanocytes. Expressed in eye muscles and thyroid follicular cells.
Target Synonyms
FLJ10128; KIAA1561; MGC141967; MGC141969; Nuclear membrane binding protein; NUCLING; UACA; UACA_HUMAN; Uveal autoantigen with coiled coil domains and ankyrin repeats; Uveal autoantigen with coiled-coil domains and ankyrin repeats
Target Background
This gene encodes a protein that contains ankyrin repeats and coiled coil domains and likely plays a role in apoptosis. Studies in rodents have implicated the encoded protein in the stimulation of apoptosis and the regulation of mammary gland involution, in which the mammary gland returns to its pre-pregnant state. This protein has also been proposed to negatively regulate apoptosis based on experiments in human cell lines in which the protein was shown to interact with PRKC apoptosis WT1 regulator protein, also known as PAR-4, and inhibit translocation of the PAR-4 receptor. Autoantibodies to this protein have been identified in human patients with panuveitis and Graves' disease. Differential expression of this gene has been observed in various human cancers.
Notification