Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2D4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D4 (NP_057067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE2D4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D4 (NP_057067.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01510A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2D4 |
| Target Synonyms | HBUCE1; UBE2D4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, BT-474, HepG2, MCF7, Mouse liver, Mouse skeletal muscle, Rat liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D4 (NP_057067.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM | Uniprot ID | Q9Y2X8 |
Uniprot Id
Q9Y2X8
Target Species
Human
Target Name
UBE2D4
Target Full Name
Ubiquitin-conjugating enzyme E2 D4
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
UBE2D4; UBCH5D; Ubiquitin-conjugating enzyme E2 D4; EC 2.3.2.23; E2 ubiquitin-conjugating enzyme D4; HBUCE1; Ubiquitin carrier protein D4; Ubiquitin-protein ligase D4
Target Background
Enables ubiquitin conjugating enzyme activity. Involved in protein polyubiquitination. Acts upstream of or within protein ubiquitination. Predicted to be part of ubiquitin ligase complex. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
