-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ULBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-217 of human ULBP2 (NP_079493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ULBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 26-217 of human ULBP2 (NP_079493.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00120A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ULBP2 |
| Target Synonyms | N2DL2; RAET1H; RAET1L; NKG2DL2; ALCAN-alpha; ULBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 26-217 of human ULBP2 (NP_079493.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS | Uniprot ID | Q9BZM5 |
Uniprot Id
Q9BZM5
Target Species
Human
Target Name
ULBP2
Target Full Name
UL16-binding protein 2
Target Function
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum. Secreted.
Target Protein Families
MHC class I family
Target Tissue Specificity
Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
Target Synonyms
ALCAN alpha; ALCAN-alpha; N2DL 2; N2DL-2; N2DL2; N2DL2_HUMAN; NKG2D ligand 2; NKG2D ligand 2 precursor; NKG2DL2; RAET1H; Retinoic acid early transcript 1 H; Retinoic acid early transcript 1H; UL16 binding protein 2; UL16-binding protein 2; ULBP2
Target Background
This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6.
Notification