Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse RNMT (NP_080716.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RNMT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse RNMT (NP_080716.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06774A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNMT |
| Target Synonyms | Rg7mt1; mKIAA0398; 2610002P10Rik; RNMT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat heart, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of mouse RNMT (NP_080716.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MEGSAKASVASDPESPPGGNEPAAASGQRLPENTPPCQQVDQPKMQKEFGEDLVEQNSSYVQDSPSKKRKLDVEIILEEKHSEDDGGSAKRSKLERGDVSEDEPSLGRLNQTKRKLQPQDDEVPQKLQKLEEGHSSAVAAHYNELQEVGL | Uniprot ID | Q9D0L8 |
Uniprot Id
Q9D0L8
Target Synonyms
Rg7mt1; mKIAA0398; 2610002P10Rik; RNMT
Target Background
Predicted to enable RNA binding activity and mRNA (guanine-N7-)-methyltransferase activity. Acts upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in fibrillar center and nucleoplasm. Predicted to be part of mRNA cap binding activity complex; mRNA cap methyltransferase complex; and receptor complex. Predicted to be active in nucleus. Is expressed in several structures, including alimentary system; cardiovascular system; central nervous system; genitourinary system; and skin. Orthologous to human RNMT (RNA guanine-7 methyltransferase).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
