Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UCP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of cattle UCP1 (NP_001160000.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UCP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of cattle UCP1 (NP_001160000.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04684A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UCP1 |
| Target Synonyms | Mitochondrial brown fat uncoupling protein 1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of cattle UCP1 (NP_001160000.1). | Immunogen Sequence | YDTVQEFFTTGKEASLGSKISAGLMTGGVAVFIGQPTEVVKVRLQAQSHLHGPKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLTRNVIINCTELVTYDLM |
|---|---|---|---|
| Uniprot ID | P10861 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
