-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BNIP3L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-180 of human BNIP3L (NP_004322.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against BNIP3L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 95-180 of human BNIP3L (NP_004322.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11999A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BNIP3L |
| Target Synonyms | NIX; BNIP3a; BNIP3L | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 95-180 of human BNIP3L (NP_004322.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGI | Uniprot ID | O60238 |
Uniprot Id
O60238
Target Species
Human
Target Name
BNIP3L
Target Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
Target Function
Induces apoptosis. Interacts with viral and cellular anti-apoptosis proteins. Can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. Inhibits apoptosis induced by BNIP3. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix. May function as a tumor suppressor.
Target Subcellular Location
Nucleus envelope. Endoplasmic reticulum. Mitochondrion outer membrane. Membrane; Single-pass membrane protein. Note=Colocalizes with SPATA18 at the mitochondrion outer membrane.
Target Protein Families
NIP3 family
Target Research Area
Cancer
Target Synonyms
Adenovirus E1B19k binding protein B5; Adenovirus E1B19K-binding protein B5; BCL2/adenovirus E1B 19 kd protein interacting protein 3a; BCL2/adenovirus E1B 19 kDa protein interacting protein 3A; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A; BCL2/adenovirus E1B 19kDa interacting protein 3 like; BNI3L_HUMAN; BNIP3a; BNIP3H; BNIP3L; BNIP3L protein; NIP3 like protein X; NIP3-like protein X; NIP3L; NIX
Target Background
This gene encodes a protein that belongs to the pro-apoptotic subfamily within the Bcl-2 family of proteins. The encoded protein binds to Bcl-2 and possesses the BH3 domain. The protein directly targets mitochondria and causes apoptotic changes, including loss of membrane potential and the release of cytochrome c.
Notification