Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNMT3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human DNMT3A (NP_072046.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNMT3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human DNMT3A (NP_072046.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13363A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNMT3A |
| Target Synonyms | TBRS; HESJAS; DNMT3A2; M.HsaIIIA; 3A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BT-474, HepG2, HT-29, MCF7, SW620 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human DNMT3A (NP_072046.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGP | Uniprot ID | Q9Y6K1 |
Uniprot Id
Q9Y6K1
Target Species
Human
Target Name
DNMT3A
Target Full Name
DNA (cytosine-5)-methyltransferase 3A
Target Function
Required for genome-wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. It modifies DNA in a non-processive manner and also methylates non-CpG sites. May preferentially methylate DNA linker between 2 nucleosomal cores and is inhibited by histone H1. Plays a role in paternal and maternal imprinting. Required for methylation of most imprinted loci in germ cells. Acts as a transcriptional corepressor for ZBTB18. Recruited to trimethylated 'Lys-36' of histone H3 (H3K36me3) sites. Can actively repress transcription through the recruitment of HDAC activity. Also has weak auto-methylation activity on Cys-710 in absence of DNA.
Target Involvement
Tatton-Brown-Rahman syndrome (TBRS)
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family
Target Tissue Specificity
Highly expressed in fetal tissues, skeletal muscle, heart, peripheral blood mononuclear cells, kidney, and at lower levels in placenta, brain, liver, colon, spleen, small intestine and lung.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DNA (cytosine 5) methyltransferase 3 alpha; DNA (cytosine 5) methyltransferase 3A; DNA (cytosine-5)-methyltransferase 3A; DNA cytosine methyltransferase 3A2; DNA methyltransferase 3 alpha; DNA methyltransferase 3a; DNA methyltransferase HsaIIIA; DNA MTase HsaIIIA; DNM3A_HUMAN; DNMT 3a; DNMT; Dnmt3a; DNMT3A2; M.HsaIIIA; MCMT; OTTHUMP00000201149; TBRS
Target Background
CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
