-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYOF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MYOF (NP_038479.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYOF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MYOF (NP_038479.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13474A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYOF |
| Target Synonyms | HAE7; FER1L3; OF | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MYOF (NP_038479.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVKDFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSAPHPNDLSGPSVPGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRR | Uniprot ID | Q9NZM1 |
Uniprot Id
Q9NZM1
Target Species
Human
Target Name
MYOF
Target Full Name
Myoferlin
Target Function
Calcium/phospholipid-binding protein that plays a role in the plasmalemma repair mechanism of endothelial cells that permits rapid resealing of membranes disrupted by mechanical stress. Involved in endocytic recycling. Implicated in VEGF signal transduction by regulating the levels of the receptor KDR.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Nucleus membrane; Single-pass type II membrane protein. Cytoplasmic vesicle membrane; Single-pass type II membrane protein.
Target Protein Families
Ferlin family
Target Tissue Specificity
Expressed in myoblast and endothelial cells (at protein level). Highly expressed in cardiac and skeletal muscles. Also present in lung, and at very low levels in kidney, placenta and brain.
Target Synonyms
Fer 1 like 3, myoferlin (C. elegans) ; Fer 1 like family member 3; Fer 1 like protein 3; Fer-1-like protein 3; FER1L3; myoF; MYOF_HUMAN; Myoferlin
Target Background
Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined.
Notification