-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 380-480 of human Cytokeratin 8 (NP_002264.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
The antibody against Cytokeratin 8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 380-480 of human Cytokeratin 8 (NP_002264.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB.
| Cat.No | ADA-15511A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 8 |
| Target Synonyms | K8; KO; CK8; CK-8; CYK8; K2C8; CARD2; 8 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse large intestine | Application | WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 380-480 of human Cytokeratin 8 (NP_002264.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDV | Uniprot ID | P05787 |
Uniprot Id
P05787
Target Species
Human
Target Name
KRT8
Target Full Name
Keratin, type II cytoskeletal 8
Target Function
Together with KRT19, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Target Involvement
Cirrhosis (CIRRH)
Target Subcellular Location
Cytoplasm. Nucleus, nucleoplasm. Nucleus matrix.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma membrane in structures that contain dystrophin and spectrin. Expressed in gingival mucosa and hard palate of the oral cavity.
Target Research Area
Immunology, Signal Transduction
Target Synonyms
CARD2; CK 8; CK-8; CK8; CYK8; CYKER; Cytokeratin endo A; Cytokeratin-8; DreK8; EndoA; K2C8; K2C8_HUMAN; K8; Keratin 8; Keratin type II cytoskeletal 8 ; Keratin; type II cytoskeletal 8; Keratin-8; KO; Krt 2.8; KRT8; MGC118110; MGC174782; MGC53564; MGC85764; sb:cb186; Type-II keratin Kb8
Target Background
This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. The product of this gene typically dimerizes with keratin 18 to form an intermediate filament in simple single-layered epithelial cells. This protein plays a role in maintaining cellular structural integrity and also functions in signal transduction and cellular differentiation. Mutations in this gene cause cryptogenic cirrhosis. Alternatively spliced transcript variants have been found for this gene.
Notification