-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GABARAPL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human GABARAPL2 (NP_009216.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GABARAPL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-50 of human GABARAPL2 (NP_009216.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00616A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GABARAPL2 |
| Target Synonyms | ATG8; GEF2; ATG8C; GEF-2; GATE16; GATE-16; GABARAPL2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, Mouse thymus, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-50 of human GABARAPL2 (NP_009216.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYL | Uniprot ID | P60520 |
Uniprot Id
P60520
Target Species
Human
Target Name
GABARAPL2
Target Full Name
Gamma-aminobutyric acid receptor-associated protein-like 2
Target Function
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Target Subcellular Location
Cytoplasmic vesicle, autophagosome. Endoplasmic reticulum membrane. Golgi apparatus.
Target Protein Families
ATG8 family
Target Tissue Specificity
Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine.
Target Research Area
Transport, Cancer
Target Synonyms
ATG8; ATG8C; FLC3A; GABA(A) receptor-associated protein-like 2; Gabarapl2; Gamma-aminobutyric acid receptor-associated protein-like 2; Ganglioside expression factor 2; GATE-16; GATE16; GBRL2_HUMAN; GEF-2; GEF2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; MAP1 light chain 3-related protein
Target Background
Enables ubiquitin protein ligase binding activity. Involved in negative regulation of proteasomal protein catabolic process and protein localization to endoplasmic reticulum. Located in Golgi membrane and autophagosome membrane.
Notification