-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC4A10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human SLC4A10 (NP_001171486.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC4A10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human SLC4A10 (NP_001171486.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00689A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC4A10 |
| Target Synonyms | NCBE; NBCn2; SLC4A10 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 640-725 of human SLC4A10 (NP_001171486.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALEKLFELSEAYPINMHNDLELLTQYSCNCVEPHNPSNGTLKEWRESNISASDIIWENLTVSECKSLHGEYVGRACGHDHPYVPDV | Uniprot ID | Q6U841 |
Uniprot Id
Q6U841
Target Species
Human
Target Name
SLC4A10
Target Full Name
Sodium-driven chloride bicarbonate exchanger
Target Function
Sodium/bicarbonate cotransporter which plays an important role in regulating intracellular pH. Has been shown to act as a sodium/bicarbonate cotransporter in exchange for intracellular chloride. Has also been shown to act as a sodium/biocarbonate cotransporter which does not couple net influx of bicarbonate to net efflux of chloride, with the observed chloride efflux being due to chloride self-exchange. Controls neuronal pH and may contribute to the secretion of cerebrospinal fluid. Reduces the excitability of CA1 pyramidal neurons and modulates short-term synaptic plasticity. Required in retinal cells to maintain normal pH which is necessary for normal vision. In the kidney, likely to mediate bicarbonate reclamation in the apical membrane of the proximal tubules.
Target Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, axon. Perikaryon. Cell junction, synapse, presynapse. Cell junction, synapse, postsynapse.
Target Protein Families
Anion exchanger (TC 2.A.31) family
Target Tissue Specificity
Predominantly expressed in the brain.
Target Synonyms
NBCn 2; NBCn2; NCBE; S4A10; S4A10_HUMAN; SLC 4A10; SLC4 A10; SLC4A 10; Slc4a10; Sodium driven chloride bicarbonate exchanger; Sodium-driven chloride bicarbonate exchanger; Solute carrier family 4 member 10; Solute carrier family 4, sodium bicarbonate cotransporter like, member 10; Solute carrier family 4, sodium bicarbonate transporter like, member 10; Solute carrier family 4, sodium bicarbonate transporter, member 10
Target Background
This gene belongs to a small family of sodium-coupled bicarbonate transporters (NCBTs) that regulate the intracellular pH of neurons, the secretion of bicarbonate ions across the choroid plexus, and the pH of the brain extracellular fluid. The protein encoded by this gene was initially identified as a sodium-driven chloride bicarbonate exchanger (NCBE) though there is now evidence that its sodium/bicarbonate cotransport activity is independent of any chloride ion countertransport under physiological conditions. This gene is now classified as a member A10 of the SLC4 family of transmembrane solute carriers. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification