Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against APOA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 227-396 of human APOA4 (NP_000473.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against APOA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 227-396 of human APOA4 (NP_000473.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00933A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | APOA4 |
| Target Synonyms | APOA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse small intestine, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 227-396 of human APOA4 (NP_000473.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES | Uniprot ID | P06727 |
Uniprot Id
P06727
Target Species
Human
Target Name
APOA4
Target Full Name
Apolipoprotein A-IV
Target Function
May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons.
Target Subcellular Location
Secreted.
Target Protein Families
Apolipoprotein A1/A4/E family
Target Tissue Specificity
Synthesized primarily in the intestine and secreted in plasma.
Target Research Area
Cancer, Cardiovascular
Target Synonyms
APOA4Apolipoprotein A-IV; Apo-AIV; ApoA-IV; Apolipoprotein A4
Target Background
Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
