-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against INF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human INF2 (NP_116103.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against INF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human INF2 (NP_116103.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01203A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | INF2 |
| Target Synonyms | FSGS5; CMTDIE; pp9484; C14orf151; C14orf173; INF2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, BT-474, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human INF2 (NP_116103.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVKEGAQRKWAALKEKLGPQDSDPTEANLESADPELCIRLLQMPSVVNYSGLRKRLEGSDGGWMVQFLEQSGLDLLLEALARLSGRGVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDN | Uniprot ID | Q27J81 |
Uniprot Id
Q27J81
Target Species
Human
Target Name
INF2
Target Full Name
Inverted formin-2
Target Function
Severs actin filaments and accelerates their polymerization and depolymerization.
Target Involvement
Focal segmental glomerulosclerosis 5 (FSGS5); Charcot-Marie-Tooth disease, dominant, intermediate type, E (CMTDIE)
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
Formin homology family
Target Tissue Specificity
Widely expressed. In the kidney, expression is apparent in podocytes and some tubule cells.
Target Synonyms
C14orf151; C14orf173; CMTDIE; DKFZp762A0214; FLJ22056; FSGS5; HBEAG binding protein 2 binding protein C; HBEBP2 binding protein C; HBEBP2-binding protein C; INF 2; inf2; INF2_HUMAN; Inverted formin 2; Inverted formin FH2 and WH2 domain containing; Inverted formin-2; MGC13251; pp9484
Target Background
This gene represents a member of the formin family of proteins. It is considered a diaphanous formin due to the presence of a diaphanous inhibitory domain located at the N-terminus of the encoded protein. Studies of a similar mouse protein indicate that the protein encoded by this locus may function in polymerization and depolymerization of actin filaments. Mutations at this locus have been associated with focal segmental glomerulosclerosis 5.
Notification