Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-176 of human IL20 (NP_061194.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IL20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-176 of human IL20 (NP_061194.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02922A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL20 |
| Target Synonyms | IL-20; IL10D; ZCYTO10; IL20 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-176 of human IL20 (NP_061194.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE | Uniprot ID | Q9NYY1 |
Uniprot Id
Q9NYY1
Target Species
Human
Target Name
IL20
Target Full Name
Interleukin-20
Target Function
Proinflammatory and angiogenic cytokine that may be involved in epidermal function and psoriasis. Angiogenic and proliferative activities are antagonized by IL10. May act through STAT3.
Target Subcellular Location
Secreted.
Target Protein Families
IL-10 family
Target Tissue Specificity
Expressed in most tissues and five major cell types: epithelial cells (primarily skin, buccal mucosa, tongue, nasal mucosa, lung, ureter, breast, prostate, fallopian tube, and adrenal gland), myoepithelial cells (mainly prostate), endothelial cells (mainl
Target Synonyms
Cytokine Zcyto10; Four alpha helix cytokine; IL-20; IL10D; IL20; IL20_HUMAN; Interleukin 20; Interleukin-20; MGC96907; UNQ852/PRO1801; ZCYTO10
Target Background
The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
