Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-146 of human PIP (NP_002643.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against PIP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-146 of human PIP (NP_002643.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of paraffin-embedded rat lung using PIP antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-03053A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIP |
| Target Synonyms | GPIP4; BRST-2; GCDFP15; GCDFP-15; PIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-146 of human PIP (NP_002643.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE | Uniprot ID | P12273 |
Uniprot Id
P12273
Target Species
Human
Target Name
PIP
Target Full Name
Prolactin-inducible protein
Target Subcellular Location
Secreted.
Target Protein Families
PIP family
Target Tissue Specificity
Expressed in pathological conditions of the mammary gland and in several exocrine tissues, such as the lacrimal, salivary, and sweat glands.
Target Research Area
Signal Transduction
Target Synonyms
BRST-2; BRST2; GCDFP-15; GCDGP15; gp17; GPIP4; Gross cystic disease fluid protein 15; PIP; PIP_HUMAN; Prolactin induced protein; Prolactin inducible protein precursor; Prolactin-induced protein; Prolactin-inducible protein; SABP; Secretory actin binding protein; Secretory actin-binding protein
Target Background
Enables IgG binding activity; aspartic-type endopeptidase activity; and identical protein binding activity. Involved in several processes, including detection of chemical stimulus involved in sensory perception of bitter taste; negative regulation of T cell apoptotic process; and proteolysis. Located in extracellular space and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
