-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL1RAPL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human IL1RAPL1 (NP_055086.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against IL1RAPL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human IL1RAPL1 (NP_055086.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04131A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL1RAPL1 |
| Target Synonyms | IL1R8; MRX10; MRX21; MRX34; OPHN4; IL1RAPL; TIGIRR-2; IL1RAPL-1; IL-1RAPL-1; IL-1-RAPL-1; IL1RAPL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, A-431, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human IL1RAPL1 (NP_055086.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDD | Uniprot ID | Q9NZN1 |
Uniprot Id
Q9NZN1
Target Species
Human
Target Name
IL1RAPL1
Target Full Name
Interleukin-1 receptor accessory protein-like 1
Target Function
May regulate secretion and presynaptic differentiation through inhibition of the activity of N-type voltage-gated calcium channel. May activate the MAP kinase JNK. Plays a role in neurite outgrowth. During dendritic spine formation can bidirectionally induce pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD.
Target Involvement
Mental retardation, X-linked 21 (MRX21)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm. Cell projection, axon. Cell projection, dendrite.
Target Protein Families
Interleukin-1 receptor family
Target Tissue Specificity
Detected at low levels in heart, skeletal muscle, ovary, skin, amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra and thalamus. Detected at very low levels in tonsil, prostate, testis, small intestine, placenta, colon and fetal live
Target Synonyms
IL 1 RAPL 1; IL 1RAPL 1; IL-1-RAPL-1; IL-1RAPL-1; IL1R8; IL1RAPL 1; IL1RAPL; IL1RAPL-1; IL1RAPL1; Interleukin 1 receptor 8; Interleukin 1 receptor accessory protein like 1; Interleukin-1 receptor accessory protein-like 1; IRPL1_HUMAN; Mental retardation X linked 10; Mental retardation X linked 21; Mental retardation X linked 34; MRX 21; MRX 34; MRX10; MRX21; MRX34; Oligophrenin 4; Oligophrenin-4; Oligophrenin4; OPHN 4; OPHN4; Three immunoglobulin domain containing IL 1 receptor related 2; Three immunoglobulin domain-containing IL-1 receptor-related 2; TIGIRR 2; TIGIRR-2; TIGIRR2; X linked interleukin 1 receptor accessory protein like 1; X-linked interleukin-1 receptor accessory protein-like 1
Target Background
The protein encoded by this gene is a member of the interleukin 1 receptor family and is similar to the interleukin 1 accessory proteins. This protein has an N-terminal signal peptide, three extracellular immunoglobulin Ig-like domains, a transmembrane domain, an intracellular Toll/IL-1R domain, and a long C-terminal tail which interacts with multiple signalling molecules. This gene is located at a region on chromosome X that is associated with a non-syndromic form of X-linked intellectual disability. Deletions and mutations in this gene were found in patients with intellectual disability. This gene is expressed at a high level in post-natal brain structures involved in the hippocampal memory system, which suggests a specialized role in the physiological processes underlying memory and learning abilities, and plays a role in synapse formation and stabilization.
Notification