Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HCRTR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-444 of human HCRTR2 (NP_001517.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HCRTR2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-444 of human HCRTR2 (NP_001517.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04199A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HCRTR2 |
| Target Synonyms | OX2R; OXR2; ORXR2; HCRTR2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-444 of human HCRTR2 (NP_001517.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW | Uniprot ID | O43614 |
Uniprot Id
O43614
Target Species
Human
Target Name
HCRTR2
Target Full Name
Orexin receptor type 2
Target Function
Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Research Area
Cardiovascular
Target Synonyms
Hcr tr2; Hcrt receptor 2; Hcrtr2; Hypocretin (orexin) receptor 2; Hypocretin receptor 2; Hypocretin receptor type 2; Orexin 2 receptor; Orexin A/Orexin B receptor; Orexin receptor 2; Orexin receptor type 2; Orexin type 2 receptor; Ox-2-R; Ox2-R; Ox2r; OX2R_HUMAN; Type 2 hypocretin receptor; Type 2 orexin receptor
Target Background
The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
