-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLEC4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLEC4A (Q9UMR7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLEC4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLEC4A (Q9UMR7) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04284A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLEC4A |
| Target Synonyms | DCIR; LLIR; CD367; DDB27; hDCIR; CLECSF6; HDCGC13P; CLEC4A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HT-29, Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLEC4A (Q9UMR7). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASLLIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE | Uniprot ID | Q9UMR7 |
Uniprot Id
Q9UMR7
Target Species
Human
Target Name
CLEC4A
Target Full Name
C-type lectin domain family 4 member A
Target Function
C-type lectin receptor that binds carbohydrates mannose and fucose but also weakly interacts with N-acetylglucosamine (GlcNAc) in a Ca(2+)-dependent manner. Involved in regulating immune reactivity. Once triggered by antigen, it is internalized by clathrin-dependent endocytosis and delivers its antigenic cargo into the antigen presentation pathway resulting in cross-priming of CD8(+) T cells. This cross-presentation and cross-priming are enhanced by TLR7 and TLR8 agonists with increased expansion of the CD8(+) T cells, high production of IFNG and TNF with reduced levels of IL4, IL5 and IL13. In plasmacytoid dendritic cells, inhibits TLR9-mediated IFNA and TNF production. May be involved via its ITIM motif (immunoreceptor tyrosine-based inhibitory motifs) in the inhibition of B-cell-receptor-mediated calcium mobilization and protein tyrosine phosphorylation.; (Microbial infection) Involved in the interaction between HIV-1 virus and dendritic cells. Enhances HIV-1 binding/entry and virus infection. Requires ITIM motif-associated signal transduction pathway involving phosphatases PTPN6 and PTPN11, SYK, Src kinases and MAP kinases.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein; Extracellular side.
Target Tissue Specificity
Expressed preferentially in hematopoietic tissues. Expressed in all circulating Ag-presenting cells such as dendritic cells, myeloid cells, monocytes, macrophages, B-cells and epidermal Langerhans cells (at protein level). Expressed in peripheral blood le
Target Synonyms
C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 6; C type lectin; C type lectin DDB27; C type lectin superfamily 6; C-type (calcium dependent; carbohydrate-recognition domain) lectin; superfamily member 6; C-type lectin superfamily member 6; C-type lectin DDB27; C-type lectin domain family 4 member A; C-type lectin domain family 4; member A; C-type lectin domain family 4; member a2; C-type lectin superfamily member 6; CLC4A_HUMAN; Clec4a; Clec4a2; CLECSF6; DCIR; Dcir1; DDB27; Dendritic cell immunoreceptor; HDCGC13P; Lectin like immunoreceptor; Lectin; C-type; superfamily member 6; Lectin-like immunoreceptor; LLIR
Target Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in inflammatory and immune response. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Notification