Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YIPF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YIPF7 (NP_872398.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against YIPF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YIPF7 (NP_872398.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04581A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YIPF7 |
| Target Synonyms | FinGER9; YIPF7 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human YIPF7 (NP_872398.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASFVPSEM | Uniprot ID | Q8N8F6 |
Uniprot Id
Q8N8F6
Target Species
Human
Target Name
YIPF7
Target Full Name
Protein YIPF7
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane. Golgi apparatus, trans-Golgi network membrane.
Target Protein Families
YIP1 family
Target Synonyms
YIPF7; FINGER9; YIP1B; Protein YIPF7; Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9; YIP1 family member 7
Target Background
Predicted to be involved in endoplasmic reticulum to Golgi vesicle-mediated transport and vesicle fusion with Golgi apparatus. Predicted to be located in endoplasmic reticulum membrane. Predicted to be integral component of membrane. Predicted to be active in trans-Golgi network.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
