Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRHR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-398 of human TRHR (NP_003292.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRHR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-398 of human TRHR (NP_003292.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05194A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRHR |
| Target Synonyms | CHNG7; TRH-R; TRHR | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 320-398 of human TRHR (NP_003292.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS | Uniprot ID | P34981 |
Uniprot Id
P34981
Target Species
Human
Target Name
TRHR
Target Full Name
Thyrotropin-releasing hormone receptor
Target Function
Receptor for thyrotropin-releasing hormone (TRH). Upon ligand binding, this G-protein-coupled receptor triggers activation of the phosphatidylinositol (IP3)-calcium-protein kinase C (PKC) pathway.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
TRHR; Thyrotropin-releasing hormone receptor; TRH-R; Thyroliberin receptor
Target Background
This gene encodes a G protein-coupled receptor for thyrotropin-releasing hormone (TRH). Upon binding to TRH, this receptor activates the inositol phospholipid-calcium-protein kinase C transduction pathway. Mutations in this gene have been associated with generalized thyrotropin-releasing hormone resistance.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
