Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LACRT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LACRT (NP_150593.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LACRT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human LACRT (NP_150593.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05527A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LACRT |
| Target Synonyms | LACRT; lacritin | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LACRT (NP_150593.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALA | Uniprot ID | Q9GZZ8 |
Uniprot Id
Q9GZZ8
Target Species
Human
Target Name
LACRT
Target Full Name
Extracellular glycoprotein lacritin
Target Function
Modulates secretion by lacrimal acinar cells.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Expressed in secretory granules of many acinar cells in lacrimal gland and in scattered acinar cells of salivary glands.
Target Synonyms
LACRTExtracellular glycoprotein lacritin
Target Background
The protein encoded by this gene is highly expressed in the lacrimal glands and localized primarily to secretory granules and secretory fluid. It augments lacrimal acinar cell secretion, promotes ductal cell proliferation, and stimulates signaling through tyrosine phosphorylation and release of calcium.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
